PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang02g10980.1
Common NameLR48_Vigan432s000800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 257aa    MW: 29367.3 Da    PI: 4.6758
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang02g10980.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.77.4e-152060345
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                     ++++eE+ l ++  +q+G++ W++Ia +++ gRt++++k++w 
   Vang02g10980.1 20 KFSAEEERLVIEMQTQFGNK-WAKIATYLP-GRTDNDVKNFWS 60
                     79******************.*********.***********6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.17E-12867IPR009057Homeodomain-like
PROSITE profilePS5129419.5071267IPR017930Myb domain
SMARTSM007174.4E-121765IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-162061IPR009057Homeodomain-like
PfamPF002492.3E-122060IPR001005SANT/Myb domain
CDDcd001671.38E-112059No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MESTYAPRRH LRPDIATGCK FSAEEERLVI EMQTQFGNKW AKIATYLPGR TDNDVKNFWS  60
SRRKRLERML QKPTTLKLQK SKGKTPLTQV LADKLFQAPP CSSNQVEENL CYTTSYMGNT  120
EVFEMINLQD LVKPNYEQME NDYLSAVEVE ATHLHTVPSF ESSSGNNFPL LPEPLIDFPL  180
FPECQDLLPE TFDPNFIDGF DEKKCSECVC SQKLGTGLPT LGLEENYQIT TSKVLFKDFP  240
SEIFEYFEQI PTSTKQ*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150390.0AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014491042.11e-162PREDICTED: transcription factor GAMYB-like
TrEMBLA0A0L9TAD70.0A0A0L9TAD7_PHAAN; Uncharacterized protein
STRINGGLYMA12G37026.11e-130(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36933164
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60460.12e-29MYB family protein
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]